PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00015.1.g04550.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 501aa    MW: 53560.9 Da    PI: 10.2718
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00015.1.g04550.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.51.3e-37292350462
                        zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +  +cprC+s++tkfCyynny+++qPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +ss
  Zjn_sc00015.1.g04550.1.am.mk 292 EGDPCPRCQSRDTKFCYYNNYNTAQPRHFCKGCRRYWTKGGTLRNVPVGGGTRKKPSSS 350
                                   5679**************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-25292343IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.202294348IPR003851Zinc finger, Dof-type
PfamPF027013.1E-31295346IPR003851Zinc finger, Dof-type
PROSITE patternPS013610296332IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MEERGERLFS ARRSRREYDE AAGRQRSSQV GPTEHYAAPT ASLASRTALL LLSDQCAKHS  60
WRRLDHSKLL PVTDAADVRA KGSTRPYGRD RAPSRYKIQR LSQARVPYAA RTNSPGTDVP  120
DPPVRQRQNV DDVQYHRAGL GVQSIDPSPH RSPRHGAAPH VTRHGVFCHA GPATAPEVLR  180
FHVAIVINRA TATIREETRT RPGRQPLSSS PSSIARSPPR SAGSLLRSLA SATHALTEPT  240
APSRMQEVSE PAGRRPGQQF AGVDLRRPKG YAAPPPPSAA AAGTHVTAAA AEGDPCPRCQ  300
SRDTKFCYYN NYNTAQPRHF CKGCRRYWTK GGTLRNVPVG GGTRKKPSSS SSSSSPSSYA  360
AAAKPKRPYK KKRRVAPPEP SVPAPAPVAC PAVDSGKTTL TTTTAVTADS AKTTTDAASE  420
ITTELVVPAA EDDALTQLLQ PEDTAVALGL GLSDFPSLGK SALHDIPDSF EWPAASFDLS  480
ACWGTAGGFA DSDPALFLNL P
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1369373KKKRR
2369374KKKRRV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9658594e-71EU965859.1 Zea mays clone 289437 dof zinc finger protein MNB1A mRNA, complete cds.
GenBankEU9693884e-71EU969388.1 Zea mays clone 329608 dof zinc finger protein MNB1A mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973764.18e-80PREDICTED: dof zinc finger protein MNB1A-like
SwissprotP385646e-73MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLA0A0A9B2221e-83A0A0A9B222_ARUDO; Dof1
TrEMBLA0A0D9X9631e-83A0A0D9X963_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g38220.12e-75(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.16e-26DOF zinc finger protein 1